PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA39152
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family CPP
Protein Properties Length: 710aa    MW: 76957.6 Da    PI: 6.0509
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA39152genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.15.6e-16421458340
                        TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                                +k+CnCkkskClk+YCeCfaag++C e C+C++C+Nk 
  Tp57577_TGAC_v2_mRNA39152 421 CKRCNCKKSKCLKLYCECFAAGVYCIEPCSCQECFNKP 458
                                89**********************************96 PP

2TCR50.63.8e-16503541139
                        TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                                ++k+gCnCkks+ClkkYCeC++ g+ Cs +C+Ce+CkN 
  Tp57577_TGAC_v2_mRNA39152 503 RHKRGCNCKKSSCLKKYCECYQGGVGCSINCRCEGCKNA 541
                                589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011144.0E-17419460IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.953420543IPR005172CRC domain
PfamPF036381.4E-11422457IPR005172CRC domain
SMARTSM011142.9E-17503544IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.2E-11505541IPR005172CRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009934Biological Processregulation of meristem structural organization
GO:0048444Biological Processfloral organ morphogenesis
GO:0051302Biological Processregulation of cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 710 aa     Download sequence    Send to blast
MVTXXXXXXX XXXXXXXXXX XXXXNKVYSN EGALADSTLS QHNSCELHDS AGQGISVGDA  60
TIELSNEQAK FSDELPQALQ YNCGSPGYDP RLCGDAANSL LELSGEAVSD VAYVRDSGKT  120
DSVEAELHLQ GTSQIDPKGE GSDCDWDGLI HNASADVLID AEAFKGLAFK GLMHGSSIRL  180
SDFVPLLQQS TSNNDQKTHL VDSVASGSEH EIHNHCSELV SVTDIDPTQD NLANGSLMTS  240
NPNEKMDNEL VSVTHRGIRR RCLDFEMASV RKKISDDNSN IGSSTTQSEV RNAANEKQLL  300
PAKRNANSQR SILRGIGLHL NALATVKDHK GKQNENVTSG DQVGLASSTS LLLSACQEHQ  360
RLSILSVSVS SERETDPSDN GVQPSEDCPQ ALAYMAADDF NQNSPKKKRR KSEPVGETEG  420
CKRCNCKKSK CLKLYCECFA AGVYCIEPCS CQECFNKPIH EDTVLQTRKQ IESRNPLAFA  480
PKVIRSADSV PEIDPNKTPA SARHKRGCNC KKSSCLKKYC ECYQGGVGCS INCRCEGCKN  540
AFGRKDGSAS IGIEGETEEE TETSDKGVDE KAIQKTEIQN IEDHPESSLV STPLQLSRPL  600
LPMPFSSKGK PPRSFVTTIT GSGYFASQKH AMPNSLWSQS KPFQTIPDDE MPEILRGDSS  660
PIACIKTSSP NGKRISSPNC EMGSSPARRG GRKLILQSIP SFPSLTPHP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1405409KKKRR
2405410KKKRRK
3406410KKRRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00624PBMTransfer from PK22848.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003610744.20.0tesmin/TSO1-like CXC domain protein
SwissprotQ9LUI31e-129TSO1_ARATH; CRC domain-containing protein TSO1
TrEMBLG7K3P90.0G7K3P9_MEDTR; Tesmin/TSO1-like CXC domain protein
STRINGGLYMA01G44670.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.11e-125TESMIN/TSO1-like CXC 2